быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
SLC3A2/CD98hc Rabbit mAb (A3658)
- Описание
- Характеристики
-
Overview
Product name SLC3A2/CD98hc Rabbit mAb Catalog No. A3658 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0816 Background
This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC3A2/CD98hc (P08195). Sequence IENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLL Gene ID Swiss Prot Synonyms 4F2; CD98; MDU1; 4F2HC; 4T2HC; NACAE; CD98HC Calculated MW 58kDa Observed MW 90kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Raji Cellular location anchoring junction, apical plasma membrane, basal plasma membrane, basolateral plasma membrane, extracellular exosome, nucleoplasm, plasma membrane Customer validation WB(Homo sapiens, Mus musculus)
Western blot analysis of extracts of various cell lines, using antibody (A3658) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC3A2/CD98hc (P08195). Isotype IgG