быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
SULT2A1 Rabbit mAb (A8334)
- Описание
- Характеристики
-
Overview
Product name SULT2A1 Rabbit mAb Catalog No. A8334 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1853 Background
This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-285 of human SULT2A1 (Q06520). Sequence LLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE Gene ID Swiss Prot Synonyms HST; ST2; STD; hSTa; DHEAS; ST2A1; ST2A3; DHEA-ST; SULT2A3; DHEA-ST8 Calculated MW 34kDa Observed MW 34kDa Applications
Reactivity Human, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Hep G2 Cellular location Cytoplasm, Cytosol 
Western blot analysis of extracts of Hep G2 cells, using SULT2A1 antibody (A8334) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of rat liver using SULT2A1 Rabbit mAb (A8334) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-285 of human SULT2A1 (Q06520). Isotype IgG