быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
MUC4 Rabbit mAb (A3438)
- Описание
- Характеристики
-
Overview
Product name MUC4 Rabbit mAb Catalog No. A3438 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1999 Background
The major constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, are highly glycosylated proteins called mucins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. This gene contains a region in the coding sequence which has a variable number (>100) of 48 nt tandem repeats.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 4807-4916 of human MUC4 (Q99102). Sequence WATVSVIALSNILHASASLPPEYQNRTEGLLGVWNNNPEDDFRMPNGSTIPPGSPEEMLFHFGMTWQINGTGLLGKRNDQLPSNFTPVFYSQLQKNSSWAEHLISNCDGD Gene ID Swiss Prot Synonyms ASGP; MUC-4; HSA276359 Calculated MW 542kDa Observed MW 120kDa Applications
Reactivity Human, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa Cellular location Extracellular exosome, Extracellular space, Golgi lumen, Plasma membrane 
Western blot analysis of extracts of various cell lines, using MUC4 Rabbit mAb (A3438) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat kidney using MUC4 Rabbit mAb (A3438) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using MUC4 Rabbit mAb (A3438) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 4807-4916 of human MUC4 (Q99102). Isotype IgG