быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
IGFBP2 Rabbit mAb (A9018)
- Описание
- Характеристики
-
Overview
Product name IGFBP2 Rabbit mAb Catalog No. A9018 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1383 Background
The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can remain intracellular, interacting with many different ligands. High expression levels of this protein promote the growth of several types of tumors and may be predictive of the chances of recovery of the patient. Several transcript variants, one encoding a secreted isoform and the others encoding nonsecreted isoforms, have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 226-325 of human IGFBP2 (P18065). Sequence PCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQ Gene ID Swiss Prot Synonyms IBP2; IGF-BP53 Calculated MW 35kDa Observed MW 35kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HepG2, PC-3 Cellular location Apical plasma membrane, cytoplasmic vesicle, extracellular exosome, extracellular region, extracellular space Customer validation (HT29,T47D)
Western blot analysis of extracts of various cell lines, using IGFBP2 antibody (A9018) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human colon using IGFBP2 Rabbit mAb (A9018) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 226-325 of human IGFBP2 (P18065). Isotype IgG
