быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Mesothelin Rabbit mAb (A9180)
- Описание
- Характеристики
-
Overview
Product name Mesothelin Rabbit mAb Catalog No. A9180 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1464 Background
This gene encodes a preproprotein that is proteolytically processed to generate two protein products, megakaryocyte potentiating factor and mesothelin. Megakaryocyte potentiating factor functions as a cytokine that can stimulate colony formation of bone marrow megakaryocytes. Mesothelin is a glycosylphosphatidylinositol-anchored cell-surface protein that may function as a cell adhesion protein. This protein is overexpressed in epithelial mesotheliomas, ovarian cancers and in specific squamous cell carcinomas. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Mesothelin (Q13421). Sequence YFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLS Gene ID Swiss Prot Synonyms MPF; SMRP Calculated MW 69kDa Observed MW 40-50kDa Applications
Reactivity Human, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, OVCAR3 Cellular location Cell surface, Endoplasmic reticulum lumen, Extracellular region, Extracellular space, Golgi apparatus, Plasma membrane 
Western blot analysis of extracts of various cell lines, using Mesothelin antibody (A9180) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of rat lung using Mesothelin Rabbit mAb (A9180) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Mesothelin (Q13421). Isotype IgG