быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
MC5 Receptor Rabbit mAb (A9331)
- Описание
- Характеристики
-
Overview
Product name MC5 Receptor Rabbit mAb Catalog No. A9331 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2739 Background
This gene encodes a member of the seven-pass transmembrane G protein-coupled melanocortin receptor protein family that stimulate cAMP signal transduction. The encoded protein is a receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone and is suggested to play a role in sebum generation.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MC5 Receptor (P33032). Sequence MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGAIVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLN Gene ID Swiss Prot Synonyms MC2 Calculated MW 37kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples PC-12, DU145, Mouse skeletal muscle, Mouse brain, Mouse spleen, Rat lung, Rat spleen Cellular location Cell membrane, Multi-pass membrane protein 
Western blot analysis of extracts of various cell lines, using (A9331) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MC5 Receptor (P33032). Isotype IgG