быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
PPP6C Rabbit mAb (A9336)
- Описание
- Характеристики
-
Overview
Product name PPP6C Rabbit mAb Catalog No. A9336 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2709 Background
This gene encodes the catalytic subunit of protein phosphatase, a component of a signaling pathway regulating cell cycle progression. Splice variants encoding different protein isoforms exist. The pseudogene of this gene is located on chromosome X.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 206-305 of human PPP6C (O00743). Sequence AISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL Gene ID Swiss Prot Synonyms PP6; PP6C Calculated MW 35kDa Observed MW 34kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, A-549, RD, Mouse brain, Mouse spleen, Rat lung, Rat brain Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using (A9336) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 206-305 of human PPP6C (O00743). Isotype IgG