быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Apolipoprotein A2 Rabbit mAb (A3321)
- Описание
- Характеристики
-
Overview
Product name Apolipoprotein A2 Rabbit mAb Catalog No. A3321 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1946 Background
This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Apolipoprotein A2 (NP_001634.1). Sequence MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ Gene ID Swiss Prot Synonyms apoAII; Apo-AII; ApoA-II Calculated MW 17kDa Observed MW 10kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Human plasma Cellular location Blood microparticle, Cytosol, Early endosome, Endoplasmic reticulum lumen, Extracellular exosome, Extracellular region 
Western blot analysis of extracts of Human plasma cells, using Apolipoprotein A2 antibody (A3321) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of rat liver using Apolipoprotein A2 Rabbit mAb (A3321) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse liver using Apolipoprotein A2 Rabbit mAb (A3321) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Apolipoprotein A2 (NP_001634.1). Isotype IgG