быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
PPM1E Rabbit mAb (A9374)
- Описание
- Характеристики
-
Overview
Product name PPM1E Rabbit mAb Catalog No. A9374 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2763 Background
This gene encodes a member of the PPM family of serine/threonine-protein phosphatases. The encoded protein is localized to the nucleus and dephosphorylates and inactivates multiple substrates including serine/threonine-protein kinase PAK 1, 5'-AMP-activated protein kinase (AMPK) and the multifunctional calcium/calmodulin-dependent protein kinases. Alternatively spliced transcript variants have been observed for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human PPM1E (Q8WY54). Sequence ESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKA Gene ID Swiss Prot Synonyms POPX1; PP2CH; caMKN; CAMKPN; CaMKP-N Calculated MW 84kDa Observed MW 100kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, SH-SY5Y Cellular location mitochondrion, nucleolus, nucleoplasm, nucleus 
Western blot analysis of extracts of various cell lines, using (A9374) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human PPM1E (Q8WY54). Isotype IgG