быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Syntaxin 16 Rabbit mAb (A9405)
- Описание
- Характеристики
-
Overview
Product name Syntaxin 16 Rabbit mAb Catalog No. A9405 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2710 Background
This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking and fusion. A microdeletion in the region of chromosome 20 where this gene is located has been associated with pseudohypoparathyroidism type Ib. Multiple transcript variants have been found for this gene. Read-through transcription also exists between this gene and the neighboring downstream aminopeptidase-like 1 (NPEPL1) gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin 16 (O14662). Sequence MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELA Gene ID Swiss Prot Synonyms SYN16; SYN-16 Calculated MW 37kDa Observed MW 37kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, SH-SY5Y, Mouse lung, Mouse brain, Mouse thymus, Rat brain, Rat pancreas Cellular location Cytoplasm, Golgi apparatus membrane, Single-pass type IV membrane protein 
Western blot analysis of various lysates, using Syntaxin 16 antibody (A9405) at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Syntaxin 16 Rabbit mAb (A9405) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using Syntaxin 16 Rabbit mAb (A9405) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using Syntaxin 16 Rabbit mAb (A9405) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin 16 (O14662). Isotype IgG