быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
MYL12B Rabbit mAb (A9387)
- Описание
- Характеристики
-
Overview
Product name MYL12B Rabbit mAb Catalog No. A9387 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2712 Background
The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 73-172 of human MYL12B (O14950). Sequence MMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD Gene ID Swiss Prot Synonyms MLC-B; MRLC2 Calculated MW 20kDa Observed MW 20kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:100 - 1:500
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples K-562, U-87MG, Mouse large intestine, Mouse lung, Mouse kidney, Rat lung, Rat brain Cellular location cell cortex, cytoplasm, cytosol, extracellular exosome, myofibril, Z disc 
Western blot analysis of extracts of various cell lines, using (A9387) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of various cell lines, using (A9387) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of Jurkat cells using MYL12B antibody (A9387) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 73-172 of human MYL12B (O14950). Isotype IgG