быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
MBD2 Rabbit mAb (A4032)
- Описание
- Характеристики
-
Overview
Product name MBD2 Rabbit mAb Catalog No. A4032 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2691 Background
DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. The protein encoded by this gene may function as a mediator of the biological consequences of the methylation signal. It is also reported that the this protein functions as a demethylase to activate transcription, as DNA methylation causes gene silencing. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MBD2 (Q9UBB5). Sequence GGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT Gene ID Swiss Prot Synonyms DMTase; NY-CO-41 Calculated MW 43kDa Observed MW 46kDa Applications
Reactivity Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse liver Cellular location cytosol, nucleoplasm, nucleus 
Western blot analysis of extracts of Mouse liver cells, using MBD2 antibody (A4032) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MBD2 (Q9UBB5). Isotype IgG







