быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
MMUT Rabbit mAb (A9406)
- Описание
- Характеристики
-
Overview
Product name MMUT Rabbit mAb Catalog No. A9406 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2734 Background
This gene encodes the mitochondrial enzyme methylmalonyl Coenzyme A mutase. In humans, the product of this gene is a vitamin B12-dependent enzyme which catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA, while in other species this enzyme may have different functions. Mutations in this gene may lead to various types of methylmalonic aciduria.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MMUT (P22033). Sequence MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMY Gene ID Swiss Prot Synonyms MCM; MUT Calculated MW 83kDa Observed MW 83kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, 293T, HepG2, Mouse kidney, Mouse heart, Rat kidney, Rat heart Cellular location Mitochondrion matrix 
Western blot analysis of extracts of various cell lines, using (A9406) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of various cell lines, using (A9406) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using MMUT Rabbit mAb (A9406) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophagus using MMUT Rabbit mAb (A9406) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MMUT (P22033). Isotype IgG