быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
CLPTM1 Rabbit mAb (A9348)
- Описание
- Характеристики
-
Overview
Product name CLPTM1 Rabbit mAb Catalog No. A9348 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2720 Background
Predicted to be involved in regulation of T cell differentiation in thymus. Located in membrane.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLPTM1 (O96005). Sequence MAAAQEADGARSAVVAAGGGSSGQVTSNGSIGRDPPAETQPQNPPAQPAPNAWQVIKGVLFRIFIIWAISSWFRRGPAPQDQAGPGGAPRVASRNLFPKD Gene ID Swiss Prot Synonyms CLPTM1; CLPTM1; transmembrane protein Calculated MW 76kDa Observed MW 100kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, U-251MG Cellular location Membrane, Multi-pass membrane protein 
Western blot analysis of extracts of various cell lines, using (A9348) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLPTM1 (O96005). Isotype IgG