быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
CCDC98 Rabbit mAb (A9421)
- Описание
- Характеристики
-
Overview
Product name CCDC98 Rabbit mAb Catalog No. A9421 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2760 Background
This gene encodes a protein that binds to the C-terminal repeats of breast cancer 1 (BRCA1) through a phospho-SXXF motif. The encoded protein recruits ubiquitin interaction motif containing 1 protein to BRCA1 protein and is required for DNA damage resistance, DNA repair, and cell cycle checkpoint control. Pseudogenes of this gene are found on chromosomes 3 and 8. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 310-409 of human CCDC98 (Q6UWZ7). Sequence SCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALDLDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF Gene ID Swiss Prot Synonyms ABRA1; CCDC98; FAM175A Calculated MW 47kDa Observed MW 50kDa Applications
Reactivity Human Tested applications WB IP Recommended dilution - WB 1:100 - 1:500
- IP 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples 293T, MCF7, SKOV3 Cellular location Nucleus 
Western blot analysis of various lysates, using CCDC98 antibody (A9421) at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 310-409 of human CCDC98 (Q6UWZ7). Isotype IgG