быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ORP1 Rabbit mAb (A9314)
- Описание
- Характеристики
-
Overview
Product name ORP1 Rabbit mAb Catalog No. A9314 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2772 Background
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. Transcript variants derived from alternative promoter usage and/or alternative splicing exist; they encode different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 851-950 of human ORP1 (Q9BXW6). Sequence SFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRSKSEEDWKTRWFHQGPNPYNGAQDWIYSGSYWDRNYFNLPDIY Gene ID Swiss Prot Synonyms ORP1; ORP-1; OSBPL1B Calculated MW 108kDa Observed MW 108kDa/50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, 293T, SH-SY5Y, Mouse brain, Mouse spleen, Mouse heart, Rat liver, Rat brain Cellular location cytosol, endosome, extracellular exosome, late endosome 
Western blot analysis of various lysates, using ORP1 Rabbit mAb (A9314) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of PC-12 cells using ORP1 Rabbit mAb (A9314) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 851-950 of human ORP1 (Q9BXW6). Isotype IgG