быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Cofilin Rabbit mAb (A2658)
- Описание
- Характеристики
-
Overview
Product name Cofilin Rabbit mAb Catalog No. A2658 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2615 Background
The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cofilin (P23528). Sequence MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLV Gene ID Swiss Prot Synonyms CFL; cofilin; HEL-S-15 Calculated MW 19kDa Observed MW 18kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, MCF7, NIH/3T3, C6, Mouse lung, Mouse thymus, Rat brain Cellular location Cell projection, Cytoplasm, Cytoplasmic side, Nucleus matrix, Peripheral membrane protein, Cytoskeleton, Lamellipodium membrane, Ruffle membrane Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using Cofilin antibody (A2658) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cofilin (P23528). Isotype IgG