быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Sterol carrier protein 2 Rabbit mAb (A9430)
- Описание
- Характеристики
-
Overview
Product name Sterol carrier protein 2 Rabbit mAb Catalog No. A9430 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2735 Background
This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sterol carrier protein 2 (P22307). Sequence MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTA Gene ID Swiss Prot Synonyms NLTP; SCOX; SCPX; SCP-2; SCP-X; NSL-TP; SCP-CHI Calculated MW 59kDa Observed MW 59kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293T, Hep G2, U-87MG, Rat liver, Rat brain Cellular location Cytoplasm, Mitochondrion, Mitochondrion, Peroxisome 
Western blot analysis of extracts of various cell lines, using (A9430) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using Sterol carrier protein 2 Rabbit mAb (A9430) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human lung cancer using Sterol carrier protein 2 Rabbit mAb (A9430) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using Sterol carrier protein 2 Rabbit mAb (A9430) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using Sterol carrier protein 2 Rabbit mAb (A9430) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of HepG2 cells using Sterol carrier protein 2 antibody (A9430) at dilution of 1:50. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using Sterol carrier protein 2 antibody (A9430) at dilution of 1:50. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using Sterol carrier protein 2 antibody (A9430) at dilution of 1:50. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using Sterol carrier protein 2 antibody (A9430) at dilution of 1:50. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sterol carrier protein 2 (P22307). Isotype IgG