быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
LIS1 Rabbit mAb (A3696)
- Описание
- Характеристики
-
Overview
Product name LIS1 Rabbit mAb Catalog No. A3696 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2075 Background
This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. This gene encodes the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LIS1 (P43034). Sequence MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPE Gene ID Swiss Prot Synonyms MDS; LIS1; LIS2; MDCR; NudF; PAFAH Calculated MW 47kDa Observed MW 47kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples U-87MG, Mouse testis, Mouse brain Cellular location axon cytoplasm, cell cortex, central region of growth cone, centrosome, cytoplasmic microtubule, cytosol, extracellular exosome, glutamatergic synapse, neuron projection, nuclear envelope, perinuclear region of cytoplasm, Schaffer collateral - CA1 synapse 
Western blot analysis of extracts of various cell lines, using LIS1 antibody (A3696) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunofluorescence analysis of C6 cells using LIS1 Rabbit mAb (A3696) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using LIS1 Rabbit mAb (A3696) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using LIS1 Rabbit mAb (A3696) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LIS1 (P43034). Isotype IgG