быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
nNOS Rabbit mAb (A2649)
- Описание
- Характеристики
-
Overview
Product name nNOS Rabbit mAb Catalog No. A2649 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2611 Background
The protein encoded by this gene belongs to the family of nitric oxide synthases, which synthesize nitric oxide from L-arginine. Nitric oxide is a reactive free radical, which acts as a biologic mediator in several processes, including neurotransmission, and antimicrobial and antitumoral activities. In the brain and peripheral nervous system, nitric oxide displays many properties of a neurotransmitter, and has been implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. This protein is ubiquitously expressed, with high level of expression in skeletal muscle. Multiple transcript variants that differ in the 5' UTR have been described for this gene but the full-length nature of these transcripts is not known. Additionally, alternatively spliced transcript variants encoding different isoforms (some testis-specific) have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1335-1434 of human nNOS (P29475). Sequence QLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAEDAGVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS Gene ID Swiss Prot Synonyms NOS; bNOS; nNOS; IHPS1; N-NOS; NC-NOS Calculated MW 161kDa Observed MW 160kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Rat brain Cellular location Cell membrane, Cell projection, Peripheral membrane protein, dendritic spine, sarcolemma Customer validation WB(Mus musculus)
Western blot analysis of extracts of Rat brain, using nNOS antibody (A2649) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunofluorescence analysis of Neuro-2a cells using nNOS Rabbit mAb (A2649) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using nNOS Rabbit mAb (A2649) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of SH-SY5Y cells using nNOS Rabbit mAb (A2649) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1335-1434 of human nNOS (P29475). Isotype IgG