быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Ephrin A1 Rabbit mAb (A9132)
- Описание
- Характеристики
-
Overview
Product name Ephrin A1 Rabbit mAb Catalog No. A9132 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1443 Background
This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ephrin A1 (P20827). Sequence MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHG Gene ID Swiss Prot Synonyms B61; EFL1; GMAN; ECKLG; EPLG1; LERK1; LERK-1; TNFAIP4 Calculated MW 24kDa Observed MW 24kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Hep G2 Cellular location Cell membrane, Secreted Customer validation WB(Homo sapiens,Mus musculus)
IHC IF(Homo sapiens,Mus musculus)
Western blot analysis of extracts of HepG2 cells, using Ephrin A1 antibody (A9132) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human brain using Ephrin A1 Rabbit mAb (A9132) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using Ephrin A1 Rabbit mAb (A9132) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ephrin A1 (P20827). Isotype IgG