быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
KMT1B / SUV39H2 Rabbit mAb (A3705)
- Описание
- Характеристики
-
Overview
Product name KMT1B / SUV39H2 Rabbit mAb Catalog No. A3705 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0829 Background
Enables S-adenosyl-L-methionine binding activity; histone methyltransferase activity (H3-K9 specific); and zinc ion binding activity. Involved in chromatin assembly or disassembly and chromatin remodeling. Acts upstream of or within cellular response to hypoxia and negative regulation of transcription by RNA polymerase II. Located in chromatin.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 311-410 of human KMT1B / SUV39H2 (Q9H5I1). Sequence ESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN Gene ID Swiss Prot Synonyms KMT1B Calculated MW 47kDa Observed MW 45kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, PC-3 Cellular location nucleoplasm, nucleus 
Western blot analysis of extracts of various cell lines, using KMT1B / SUV39H2 antibody (A3705) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 311-410 of human KMT1B / SUV39H2 (Q9H5I1). Isotype IgG