быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Tbx3 Rabbit mAb (A9646)
- Описание
- Характеристики
-
Overview
Product name Tbx3 Rabbit mAb Catalog No. A9646 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1677 Background
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 644-743 of human Tbx3 (O15119). Sequence SIPVPVPDGSSLLTTALPSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLSSSSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRSASP Gene ID Swiss Prot Synonyms UMS; XHL; TBX3-ISO Calculated MW 79kDa Observed MW 98kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse lung, Rat liver Cellular location cilium, nucleus 
Western blot analysis of extracts of various cell lines, using Tbx3 antibody (A9646) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 644-743 of human Tbx3 (O15119). Isotype IgG







