быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Cdx1 Rabbit mAb (A9546)
- Описание
- Характеристики
-
Overview
Product name Cdx1 Rabbit mAb Catalog No. A9546 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1627 Background
This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cdx1 (P47902). Sequence MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSP Gene ID Swiss Prot Synonyms Calculated MW 28kDa Observed MW 28kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, SGC-7901 Cellular location nucleus 
Western blot analysis of extracts of various cell lines, using Cdx1 antibody (A9546) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cdx1 (P47902). Isotype IgG