быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
CXCR7 Rabbit mAb (A8991)
- Описание
- Характеристики
-
Overview
Product name CXCR7 Rabbit mAb Catalog No. A8991 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1374 Background
This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 263-362 of human CXCR7 (NP_064707.1). Sequence VCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK Gene ID Swiss Prot Synonyms RDC1; CXCR7; RDC-1; CMKOR1; CXC-R7; CXCR-7; GPR159 Calculated MW 41kDa Observed MW 38kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-937, SH-SY5Y, HUVEC Cellular location Cell surface, Early endosome, Nucleus, Plasma membrane, Recycling endosome 
Western blot analysis of extracts of various cell lines, using CXCR7 antibody (A8991) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 263-362 of human CXCR7 (NP_064707.1). Isotype IgG