быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
GRK3 Rabbit mAb (A9163)
- Описание
- Характеристики
-
Overview
Product name GRK3 Rabbit mAb Catalog No. A9163 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1458 Background
The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 589-688 of human GRK3 (P35626). Sequence EWRGEGESRQNLLTMEQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPRSGTVELPKPSLCHRNSNGL Gene ID Swiss Prot Synonyms BARK2; ADRBK2 Calculated MW 80kDa Observed MW 80kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, SH-SY5Y Cellular location cell projection, cytosol, plasma membrane, postsynapse, presynapse 
Western blot analysis of extracts of various cell lines, using GRK3 antibody (A9163) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 589-688 of human GRK3 (P35626). Isotype IgG