быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
KIF3A Rabbit mAb (A7370)
- Описание
- Характеристики
-
Overview
Product name KIF3A Rabbit mAb Catalog No. A7370 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1428 Background
Enables protein phosphatase binding activity; small GTPase binding activity; and spectrin binding activity. Involved in protein localization to cell junction and protein transport. Located in centriole and centrosome. Part of kinesin II complex. Colocalizes with spindle microtubule.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-699 of human KIF3A (Q9Y496). Sequence YQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ Gene ID Swiss Prot Synonyms FLA10; KLP-20 Calculated MW 80kDa Observed MW 80kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples SH-SY5Y, Rat testis Cellular location axon cytoplasm, centriole, centrosome, ciliary tip, cilium, cytosol, extracellular exosome, microtubule cytoskeleton 
Western blot analysis of extracts of various cell lines, using KIF3A antibody (A7370) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat testis using KIF3A Rabbit mAb (A7370) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using KIF3A Rabbit mAb (A7370) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-699 of human KIF3A (Q9Y496). Isotype IgG