быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
TFF3 Rabbit mAb (A4592)
- Описание
- Характеристики
-
Overview
Product name TFF3 Rabbit mAb Catalog No. A4592 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2664 Background
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-80 of human TFF3 (Q07654). Sequence MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF Gene ID Swiss Prot Synonyms ITF; P1B; TFI Calculated MW 9kDa Observed MW Applications
Reactivity Human Tested applications IHC-P Recommended dilution - IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location extracellular region, extracellular space Customer validation IHC(Homo sapiens)
Immunohistochemistry of paraffin-embedded human appendix using TFF3 Rabbit mAb (A4592) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon carcinoma using TFF3 Rabbit mAb (A4592) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon using TFF3 Rabbit mAb (A4592) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-80 of human TFF3 (Q07654). KO Validated Validated Isotype IgG