быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
SAMHD1 Rabbit mAb (A4607)
- Описание
- Характеристики
-
Overview
Product name SAMHD1 Rabbit mAb Catalog No. A4607 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1050 Background
This gene may play a role in regulation of the innate immune response. The encoded protein is upregulated in response to viral infection and may be involved in mediation of tumor necrosis factor-alpha proinflammatory responses. Mutations in this gene have been associated with Aicardi-Goutieres syndrome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 527-626 of human SAMHD1 (NP_056289.2). Sequence NRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM Gene ID Swiss Prot Synonyms DCIP; CHBL2; HDDC1; MOP-5; SBBI88; hSAMHD1 Calculated MW 72kDa Observed MW 72kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HepG2, Raji Cellular location Nucleoplasm, Nucleus, Plasma membrane, Tetraspanin-enriched microdomain 
Western blot analysis of extracts of various cell lines, using SAMHD1 antibody (A4607) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human appendix using SAMHD1 Rabbit mAb (A4607) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 527-626 of human SAMHD1 (NP_056289.2). Isotype IgG