быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
DPP3 Rabbit mAb (A9351)
- Описание
- Характеристики
-
Overview
Product name DPP3 Rabbit mAb Catalog No. A9351 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2778 Background
This gene encodes a protein that is a member of the M49 family of metallopeptidases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 638-737 of human DPP3 (Q9NY33). Sequence RALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEILTQLATADARFWKGPSEAPSGQA Gene ID Swiss Prot Synonyms DPPIII Calculated MW 83kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, HCT116, A-431, Rat testis, Rat brain, Rat liver, Mouse large intestine, Mouse heart Cellular location Cytoplasm 
Western blot analysis of various lysates, using DPP3 Rabbit mAb (A9351) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts of various cell lines, using (A9351) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of various lysates, using DPP3 Rabbit mAb (A9351) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 638-737 of human DPP3 (Q9NY33). Isotype IgG