быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
COX2/PTGS2 Rabbit mAb (A3560)
- Описание
- Характеристики
-
Overview
Product name COX2/PTGS2 Rabbit mAb Catalog No. A3560 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0800 Background
Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes the inducible isozyme. It is regulated by specific stimulatory events, suggesting that it is responsible for the prostanoid biosynthesis involved in inflammation and mitogenesis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 505-604 of human COX2/PTGS2 (P35354). Sequence GETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL Gene ID Swiss Prot Synonyms COX2; COX-2; PHS-2; PGG/HS; PGHS-2; hCox-2; GRIPGHS Calculated MW 69kDa Observed MW 72kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa+LPS, RAW 264.7+LPS, Rat brain Cellular location caveola, cytoplasm, endoplasmic reticulum, endoplasmic reticulum lumen, neuron projection Customer validation (Hela,NIH/3T3)
WB(Homo sapiens,Mus musculus, Rattus norvegicus)
IF(Rattus norvegicus)
IHC(Rattus norvegicus, Homo sapiens, Mus musculus)
ELISA(Rattus norvegicus)
Western blot analysis of extracts of various cell lines, using COX2/PTGS2 antibody (A3560) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human colon using COX2/PTGS2 Rabbit mAb (A3560) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using COX2/PTGS2 Rabbit mAb (A3560) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 505-604 of human COX2/PTGS2 (P35354). Isotype IgG