быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
MAGOH Rabbit mAb (A3579)
- Описание
- Характеристики
-
Overview
Product name MAGOH Rabbit mAb Catalog No. A3579 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2048 Background
Drosophila that have mutations in their mago nashi (grandchildless) gene produce progeny with defects in germplasm assembly and germline development. This gene encodes the mammalian mago nashi homolog. In mammals, mRNA expression is not limited to the germ plasm, but is expressed ubiquitously in adult tissues and can be induced by serum stimulation of quiescent fibroblasts.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 67-146 of human MAGOH (P61326). Sequence SEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI Gene ID Swiss Prot Synonyms MAGOH1; MAGOHA Calculated MW 17kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A-549, Jurkat, Mouse spleen, Rat thymus, Rat lung, Rat spleen Cellular location cytosol, nuclear speck, nucleoplasm, nucleus 
Western blot analysis of extracts of various cell lines, using MAGOH antibody (A3579) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using MAGOH antibody (A3579) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 67-146 of human MAGOH (P61326). Isotype IgG