быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Apolipoprotein A1 Rabbit mAb (A4163)
- Описание
- Характеристики
-
Overview
Product name Apolipoprotein A1 Rabbit mAb Catalog No. A4163 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0911 Background
This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apolipoprotein A1 (P02647). Sequence MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLE Gene ID Swiss Prot Synonyms HPALP2; apo(a) Calculated MW 28kDa Observed MW 25kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Human plasma Cellular location Blood microparticle, cytoplasmic vesicle, cytosol, early endosome, endoplasmic reticulum lumen, extracellular exosome, extracellular region, extracellular space, extracellular vesicle, plasma membrane Customer validation WB(Homo sapiens)

Western blot analysis of extracts of human plasma cells, using Apolipoprotein A1 antibody (A4163) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of Hep G2 cells using Apolipoprotein A1 Rabbit mAb (A4163) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apolipoprotein A1 (P02647). Isotype IgG







