быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
TAF15 Rabbit mAb (A9383)
- Описание
- Характеристики
-
Overview
Product name TAF15 Rabbit mAb Catalog No. A9383 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2765 Background
This gene encodes a member of the TET family of RNA-binding proteins. The encoded protein plays a role in RNA polymerase II gene transcription as a component of a distinct subset of multi-subunit transcription initiation factor TFIID complexes. Translocations involving this gene play a role in acute leukemia and extraskeletal myxoid chondrosarcoma, and mutations in this gene may play a role in amyotrophic lateral sclerosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 493-592 of human TAF15 (Q92804). Sequence GYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY Gene ID Swiss Prot Synonyms Npl3; RBP56; TAF2N; TAFII68 Calculated MW 62kDa Observed MW 75kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples HeLa, 293T, HT-29, Mouse thymus Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using (A9383) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human lung cancer using TAF15 Rabbit mAb (A9383) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using TAF15 Rabbit mAb (A9383) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse testis using TAF15 Rabbit mAb (A9383) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat lung using TAF15 Rabbit mAb (A9383) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat stomach using TAF15 Rabbit mAb (A9383) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa cells using TAF15 antibody (A9383) at dilution of 1:25. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using TAF15 antibody (A9383) at dilution of 1:25. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using TAF15 antibody (A9383) at dilution of 1:25. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg TAF15 antibody (A9383). Western blot was performed from the immunoprecipitate using TAF15 antibody (A9383) at a dilution of 1:500.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 493-592 of human TAF15 (Q92804). Isotype IgG