быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Cytokeratin 17 (KRT17) Rabbit mAb (A3769)
- Описание
- Характеристики
-
Overview
Product name Cytokeratin 17 (KRT17) Rabbit mAb Catalog No. A3769 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0271 Background
This gene encodes the type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in this gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 17 (KRT17) (Q04695). Sequence MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLD Gene ID Swiss Prot Synonyms PC; K17; PC2; 39.1; CK-17; PCHC1 Calculated MW 48kDa Observed MW 48kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location Cytoplasm 
Western blot analysis of HeLa, using Cytokeratin 17 (KRT17) Rabbit mAb (A3769) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 17 (KRT17) (Q04695). Isotype IgG