быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
GRM5 Rabbit mAb (A3758)
- Описание
- Характеристики
-
Overview
Product name GRM5 Rabbit mAb Catalog No. A3758 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0250 Background
This gene encodes a member of the G-protein coupled receptor 3 protein family. The encoded protein is a metabatropic glutamate receptor, whose signaling activates a phosphatidylinositol-calcium second messenger system. This protein may be involved in the regulation of neural network activity and synaptic plasticity. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. A pseudogene of this gene has been defined on chromosome 11. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human GRM5 (P41594). Sequence PKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAARESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL Gene ID Swiss Prot Synonyms mGlu5; GPRC1E; MGLUR5; PPP1R86 Calculated MW 132kDa Observed MW 150kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse brain Cellular location Cell membrane, Multi-pass membrane protein Customer validation WB(Rattus norvegicus)

Western blot analysis of extracts of Mouse brain, using GRM5 antibody (A3758) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human GRM5 (P41594). Isotype IgG







