быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
MDA5 Rabbit mAb (A2419)
- Описание
- Характеристики
-
Overview
Product name MDA5 Rabbit mAb Catalog No. A2419 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0760 Background
IFIH1 encodes MDA5 which is an intracellular sensor of viral RNA that triggers the innate immune response. Sensing RNA length and secondary structure, MDA5 binds dsRNA oligonucleotides with a modified DExD/H-box helicase core and a C-terminal domain, thus leading to a proinflammatory response that includes interferons. It has been shown that Coronaviruses (CoVs) as well as various other virus families, are capable of evading the MDA5-dependent interferon response, thus impeding the activation of the innate immune response to infection. MDA5 has also been shown to play an important role in enhancing natural killer cell function in malaria infection. In addition to its protective role in antiviral responses, MDA5 has been implicated in autoimmune and autoinflammatory diseases such as type 1 diabetes, systemic lupus erythematosus, and Aicardi-Goutieres syndromeImmunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human MDA5 (Q9BYX4). Sequence PSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQY Gene ID Swiss Prot Synonyms AGS7; Hlcd; MDA5; IMD95; MDA-5; RLR-2; IDDM19; SGMRT1 Calculated MW 117kDa Observed MW 135kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples BxPC-3, TPA+LPS+C6, Mouse lung Cellular location cytoplasm, cytosol, mitochondrion, nucleus Customer validation WB(Homo sapiens, Mus musculus)
IHC(Mus musculus)
IP(Homo sapiens)
Western blot analysis of extracts of various cell lines, using MDA5 antibody (A2419) at 1:1000 dilution.C6 cells were treated by LPS for 6 hours and Brefeldin A for 3 hours of stimulation.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of BxPC-3 cells, using MDA5 antibody (A2419) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human MDA5 (Q9BYX4). Isotype IgG