быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
DNA Polymerase beta Rabbit mAb (A2412)
- Описание
- Характеристики
-
Overview
Product name DNA Polymerase beta Rabbit mAb Catalog No. A2412 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0752 Background
The protein encoded by this gene is a DNA polymerase involved in base excision and repair, also called gap-filling DNA synthesis. The encoded protein, acting as a monomer, is normally found in the cytoplasm, but it translocates to the nucleus upon DNA damage. Several transcript variants of this gene exist, but the full-length nature of only one has been described to date.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 236-335 of human DNA Polymerase beta (P06746). Sequence MGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE Gene ID Swiss Prot Synonyms POLB; DNA polymerase beta Calculated MW 38kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, A-431, Jurkat, Mouse testis, Mouse spleen, Mouse thymus, Rat testis, Rat spleen Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using DNA Polymerase beta Rabbit mAb (A2412) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded rat testis using DNA Polymerase beta Rabbit mAb (A2412) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse testis using DNA Polymerase beta Rabbit mAb (A2412) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 236-335 of human DNA Polymerase beta (P06746). Isotype IgG