быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
RAB4A Rabbit mAb (A3979)
- Описание
- Характеристики
-
Overview
Product name RAB4A Rabbit mAb Catalog No. A3979 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2607 Background
This gene is a member of the largest group in the Ras superfamily of small GTPases, which regulate membrane trafficking. The encoded protein is associated with early endosomes and is involved in their sorting and recycling. The protein also plays a role in regulating the recycling of receptors from endosomes to the plasma membrane. Alternatively spliced transcript variants have been observed for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB4A (P20338). Sequence MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRET Gene ID Swiss Prot Synonyms RAB4; HRES1; HRES-1; HRES-1/RAB4 Calculated MW 24kDa Observed MW 25kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples MCF7, U-251MG, Neuro-2a, Mouse brain, Mouse kidney Cellular location Cytoplasm, Membrane, Peripheral membrane protein 
Western blot analysis of various lysates, using RAB4A Rabbit mAb (A3979) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB4A (P20338). Isotype IgG