быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Galectin 8/LGALS8 Rabbit mAb (A4383)
- Описание
- Характеристики
-
Overview
Product name Galectin 8/LGALS8 Rabbit mAb Catalog No. A4383 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0990 Background
This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Galectin 8/LGALS8 (O00214). Sequence MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKRE Gene ID Swiss Prot Synonyms Gal-8; PCTA1; PCTA-1; Po66-CBP Calculated MW 36kDa Observed MW 40kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse spleen, Rat liver, Rat kidney Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using Galectin 8/LGALS8Rabbit mAb (A4383) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Galectin 8/LGALS8 (O00214). Isotype IgG