быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
PAK2 Rabbit mAb (A4553)
- Описание
- Характеристики
-
Overview
Product name PAK2 Rabbit mAb Catalog No. A4553 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1030 Background
The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAK2 (Q13177). Sequence MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPE Gene ID Swiss Prot Synonyms KNO2; PAK65; PAKgamma; p58; PAK-2; S6/H4 kinase Calculated MW 58kDa Observed MW 61kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, 293T, Jurkat, Mouse brain, Mouse thymus, Rat testis, Rat brain Cellular location Cytoplasm, Cytoplasm, Lipid-anchor, Membrane, Nucleus, perinuclear region 
Western blot analysis of extracts of various cell lines, using PAK2 Rabbit mAb (A4553) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of C6 cells using PAK2 antibody (A4553) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using PAK2 antibody (A4553) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using PAK2 antibody (A4553) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAK2 (Q13177). Isotype IgG