быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Peroxiredoxin 2 (PRDX2) Rabbit mAb (A4308)
- Описание
- Характеристики
-
Overview
Product name Peroxiredoxin 2 (PRDX2) Rabbit mAb Catalog No. A4308 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0963 Background
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 2 (PRDX2) (P32119). Sequence MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLN Gene ID Swiss Prot Synonyms PRP; TSA; PRX2; PTX1; TPX1; NKEFB; PRXII; TDPX1; NKEF-B; HEL-S-2a Calculated MW 22kDa Observed MW 22kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, K-562, SH-SY5Y, Mouse brain, Mouse heart, Rat brain, Rat spleen, Rat heart Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using Peroxiredoxin 2 (PRDX2) (PRDX2) Rabbit mAb (A4308) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 2 (PRDX2) (P32119). Isotype IgG







