быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Emerin/EMD Rabbit mAb (A4187)
- Описание
- Характеристики
-
Overview
Product name Emerin/EMD Rabbit mAb Catalog No. A4187 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0921 Background
Emerin is a serine-rich nuclear membrane protein and a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Dreifuss-Emery muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the emerin gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-254 of human Emerin/EMD (P50402). Sequence RERPMYGRDSAYQSITHYRPVSASRSSLDLSYYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLFFIYHFMQAEEGNPF Gene ID Swiss Prot Synonyms STA; EDMD; LEMD5 Calculated MW 29kDa Observed MW 30kDa/35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples THP-1, Mouse brain, Rat lung Cellular location Nucleoplasmic side, Nucleus inner membrane, Nucleus outer membrane, Single-pass membrane protein 
Western blot analysis of extracts of various cell lines, using Emerin/EMD Rabbit mAb (A4187) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human colon using Emerin/EMD Rabbit mAb (A4187) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Confocal imaging of HeLa cells using Emerin/EMD Rabbit mAb (A4187, dilution 1:100) (Red). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC049, dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-254 of human Emerin/EMD (P50402). Isotype IgG