быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
HTRA2 Rabbit mAb (A3904)
- Описание
- Характеристики
-
Overview
Product name HTRA2 Rabbit mAb Catalog No. A3904 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0864 Background
This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HTRA2 (O43464). Sequence GTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVV Gene ID Swiss Prot Synonyms OMI; MGCA8; PARK13; PRSS25 Calculated MW 49kDa Observed MW 36kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, SH-SY5Y, Mouse liver, Mouse brain, Mouse kidney, Rat brain, Rat kidney Cellular location Mitochondrion intermembrane space, Mitochondrion membrane, Single-pass membrane protein Customer validation (293T、Hela、HepG2、RPMI-8226、PC-3、A549、MOLT-4、K-562)
IHC(Mus musculus)
Western blot analysis of extracts of various cell lines, using HTRA2 Rabbit mAb (A3904) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
-
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HTRA2 (O43464). Isotype IgG