быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
NUDEL/NDEL1 Rabbit mAb (A3799)
- Описание
- Характеристики
-
Overview
Product name NUDEL/NDEL1 Rabbit mAb Catalog No. A3799 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0835 Background
Enables identical protein binding activity. Involved in chromosome segregation; positive regulation of GTPase activity; and regulation of intracellular protein transport. Located in kinetochore. Biomarker of schizophrenia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDEL/NDEL1 (Q9GZM8). Sequence MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDD Gene ID Swiss Prot Synonyms EOPA; NDE2; NUDEL; MITAP1; NDE1L1 Calculated MW 38kDa Observed MW 40kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, A-549, U-87MG, Mouse lung, Mouse brain, Rat brain, Rat heart Cellular location Chromosome, Cytoplasm, centromere, centrosome, cytoskeleton, kinetochore, microtubule organizing center, spindle 
Western blot analysis of extracts of various cell lines, using NUDEL/NDEL1 Rabbit mAb (A3799) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDEL/NDEL1 (Q9GZM8). Isotype IgG