быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Gephyrin Rabbit mAb (A4729)
- Описание
- Характеристики
-
Overview
Product name Gephyrin Rabbit mAb Catalog No. A4729 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1109 Background
This gene encodes a neuronal assembly protein that anchors inhibitory neurotransmitter receptors to the postsynaptic cytoskeleton via high affinity binding to a receptor subunit domain and tubulin dimers. In nonneuronal tissues, the encoded protein is also required for molybdenum cofactor biosynthesis. Mutations in this gene may be associated with the neurological condition hyperplexia and also lead to molybdenum cofactor deficiency. Numerous alternatively spliced transcript variants encoding different isoforms have been described; however, the full-length nature of all transcript variants is not currently known.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Gephyrin (NP_001019389). Sequence MATEGMILTNHDHQIRVGVLTVSDSCFRNLAEDRSGINLKDLVQDPSLLGGTISAYKIVPDEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEAT Gene ID Swiss Prot Synonyms GPH; GEPH; HKPX1; GPHRYN; MOCODC Calculated MW 80kDa/83kDa Observed MW 93kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, Hep G2, Mouse liver, Rat liver Cellular location Cell junction, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, cytoskeleton, postsynaptic cell membrane, synapse 
Western blot analysis of extracts of various cell lines, using Gephyrin Rabbit mAb (A4729) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using Gephyrin Rabbit mAb (A4729) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Gephyrin (NP_001019389). Isotype IgG