быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Desmin Rabbit mAb (A3736)
- Описание
- Характеристики
-
Overview
Product name Desmin Rabbit mAb Catalog No. A3736 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0235 Background
This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 371-470 of human Desmin (P17661). Sequence EEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL Gene ID Swiss Prot Synonyms CSM1; CSM2; CDCD3; LGMD1D; LGMD1E; LGMD2R Calculated MW 54kDa Observed MW 54kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:1000 - 1:5000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples C2C12, RD, Mouse lung, Mouse heart, Rat heart Cellular location Cell membrane, Cytoplasm, sarcolemma Customer validation IHC(Homo sapiens,Mus musculus)
WB(Mus musculus)
IF(Mus musculus, Homo sapiens)
Western blot analysis of extracts of various cell lines, using Desmin Rabbit mAb (A3736) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon using Desmin Rabbit mAb (A3736) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of mouse heart using Desmin Rabbit mAb (A3736) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of rat heart using Desmin Rabbit mAb (A3736) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 371-470 of human Desmin (P17661). Isotype IgG