быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Peroxiredoxin 3 (PRDX3) Rabbit mAb (A2398)
- Описание
- Характеристики
-
Overview
Product name Peroxiredoxin 3 (PRDX3) Rabbit mAb Catalog No. A2398 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0747 Background
This gene encodes a mitochondrial protein with antioxidant function. The protein is similar to the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase, and it can rescue bacterial resistance to alkylhydroperoxide in E. coli that lack the C22 subunit. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologs suggest that these genes consist of a family that is responsible for the regulation of cellular proliferation, differentiation and antioxidant functions. This family member can protect cells from oxidative stress, and it can promote cell survival in prostate cancer. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 3, 13 and 22.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 157-256 of human Peroxiredoxin 3 (PRDX3) (PRDX3) (P30048). Sequence NIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ Gene ID Swiss Prot Synonyms AOP1; MER5; AOP-1; PPPCD; SP-22; HBC189; SCAR32; PRO1748; prx-III Calculated MW 28kDa Observed MW 25kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Hep G2, MCF7, U-87MG, Mouse liver Cellular location Mitochondrion, Cytoplasm, Endosome 
Western blot analysis of extracts of various cell lines, using Peroxiredoxin 3 (PRDX3) (PRDX3) Rabbit mAb (A2398) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human colon using Peroxiredoxin 3 (PRDX3) (PRDX3) Rabbit mAb (A2398) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Confocal imaging of U-2 OS cells using Peroxiredoxin 3 (PRDX3) Rabbit mAb (A2398, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 157-256 of human Peroxiredoxin 3 (PRDX3) (PRDX3) (P30048). Isotype IgG