быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
MBNL1 Rabbit mAb (A5149)
- Описание
- Характеристики
-
Overview
Product name MBNL1 Rabbit mAb Catalog No. A5149 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1199 Background
This gene encodes a member of the muscleblind protein family which was initially described in Drosophila melanogaster. The encoded protein is a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Mice lacking this gene exhibited muscle abnormalities and cataracts. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. The different isoforms are thought to have different binding specificities and/or splicing activities.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 289-388 of human MBNL1 (Q9NR56). Sequence IPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM Gene ID Swiss Prot Synonyms EXP; MBNL Calculated MW 42kDa Observed MW 40kDa, 42kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HepG2, MCF7 Cellular location Cytoplasm, Cytoplasmic granule, Nucleus 
Western blot analysis of extracts of various cell lines, using MBNL1 Rabbit mAb (A5149) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunofluorescence analysis of U-2 OS cells using MBNL1 Rabbit mAb (A5149) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 289-388 of human MBNL1 (Q9NR56). Isotype IgG







