быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
AP2A1 Rabbit mAb (A4403)
- Описание
- Характеристики
-
Overview
Product name AP2A1 Rabbit mAb Catalog No. A4403 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0998 Background
This gene encodes the alpha 1 adaptin subunit of the adaptor protein 2 (AP-2) complex found in clathrin coated vesicles. The AP-2 complex is a heterotetramer consisting of two large adaptins (alpha or beta), a medium adaptin (mu), and a small adaptin (sigma). The complex is part of the protein coat on the cytoplasmic face of coated vesicles which links clathrin to receptors in vesicles. Alternative splicing of this gene results in two transcript variants encoding two different isoforms. A third transcript variant has been described, but its full length nature has not been determined.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human AP2A1 (O95782). Sequence MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISV Gene ID Swiss Prot Synonyms ADTAA; CLAPA1; AP2-ALPHA Calculated MW 108kDa Observed MW 100-108kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples MCF7, U-251MG, Mouse testis, Mouse brain, Rat brain Cellular location Cell membrane, Cytoplasmic side, Membrane, Peripheral membrane protein, coated pit 
Western blot analysis of extracts of various cell lines, using AP2A1 Rabbit mAb (A4403) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of C6 cells using AP2A1 Rabbit mAb (A4403) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using AP2A1 Rabbit mAb (A4403) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human AP2A1 (O95782). Isotype IgG